DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and Rab19

DIOPT Version :9

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001261575.1 Gene:Rab19 / 38930 FlyBaseID:FBgn0015793 Length:219 Species:Drosophila melanogaster


Alignment Length:216 Identity:68/216 - (31%)
Similarity:114/216 - (52%) Gaps:23/216 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EDDIELAIKVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVRIMLWDTAG 95
            |:..:...|:|::|:.|.||:.::.|:..|.:.:.:..||||||..:.|.::|:.:::.:|||||
  Fly    15 EEHFDFLFKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKLQIWDTAG 79

  Fly    96 QEEFDCITKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVEN-ECNEIPTVIVQNKIDLIEQAVV 159
            ||.|..||::|||.|...::|:..|.|:||..::.|..:|.. ..:.:..::|.||.||.||..|
  Fly    80 QERFRTITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASNVLIILVGNKCDLEEQREV 144

  Fly   160 TADEVETLAKLLNCRLI-------RTSVKEDINVASVFRYLATKCHQLMTQSYDQVAGNQQNSSH 217
            ..:|...:     |:.|       .||.||::||...||.||.:    :.:.:|     ..|...
  Fly   145 DFEEARQM-----CQYIPEILFVMETSAKENMNVEDAFRCLANE----LKRQHD-----ANNVEE 195

  Fly   218 PPYSSTPTISAFSPTFTKSSS 238
            .| .:|.|:....|..:.|||
  Fly   196 VP-ENTITLGQGKPLKSCSSS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Ras 50..199 CDD:278499 53/156 (34%)
Rab23_like 50..197 CDD:133306 53/154 (34%)
Rab19NP_001261575.1 Rab19 19..184 CDD:133267 58/173 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454146
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.