DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and RabX5

DIOPT Version :9

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster


Alignment Length:222 Identity:66/222 - (29%)
Similarity:102/222 - (45%) Gaps:19/222 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SQAQYNYTSMREDDIELAIKVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGE 84
            :|.:|...:.|:.... ..||:.||:..|||::::.|:|...|..:||.||||||......|.|.
  Fly    48 AQVRYYLEAPRKPKFR-PCKVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGH 111

  Fly    85 DVRIMLWDTAGQEEFDCITKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVEN-ECNEIPTV-IV 147
            :..:.:|||||||.|.||..||||.|...|:.:..:.:.|.::.|.|.....| ..::.|.| :|
  Fly   112 NYSLEMWDTAGQERFRCIAGAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLV 176

  Fly   148 QNKIDLI--EQAVVTADEVETLAKL----LNCRLIRTSVKEDINVASVFRYLATKCHQLMTQSYD 206
            ..|.||:  |:.|    .:|.||.|    |.......|.:....|..:|:.:|....:      :
  Fly   177 GTKADLLSKEEFV----RMERLAGLAAAELQAEYWSVSARSGFKVTELFQRIAALAFE------E 231

  Fly   207 QVAGNQQNSSHPPYSSTPTISAFSPTF 233
            .|....::..:.|.......|..|.||
  Fly   232 AVMQEIRSIKNKPQEQATQASVKSQTF 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Ras 50..199 CDD:278499 51/156 (33%)
Rab23_like 50..197 CDD:133306 51/154 (33%)
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 57/167 (34%)
RAB 66..225 CDD:197555 56/162 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454425
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.