DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and RabX6

DIOPT Version :9

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster


Alignment Length:203 Identity:56/203 - (27%)
Similarity:97/203 - (47%) Gaps:28/203 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KVVIVGNGGVGKSSMIQRYCKGIF--TKDYKKTIGVDFLERQIEIDGEDVRIMLWDTAGQEEFDC 101
            ||::.|:.||||||:.:|:....|  ..|.|.|:|:|.::|:..::.:.:::.||||.|.|....
  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74

  Fly   102 ITKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVENECNEIPTVIVQNKIDLI-EQAVVTADEVE 165
            :|.:||:.|:.::|||:..:.|||.::......:..........|..||.||. .:..|:.:|||
  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYAENAKIFICGNKSDLDGREPEVSDEEVE 139

  Fly   166 TLAKLLNCRLI-----RTSVKEDINVASVFR-----------------YLATKCHQLMTQSYDQV 208
            ...:  .|..:     :||.:....|..:||                 .|..|..|:.|.| ...
  Fly   140 AFCE--QCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDTAS-SGA 201

  Fly   209 AGNQQNSS 216
            |.|::::|
  Fly   202 ATNEEDAS 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Ras 50..199 CDD:278499 44/173 (25%)
Rab23_like 50..197 CDD:133306 43/171 (25%)
RabX6NP_001261219.1 RAB 10..176 CDD:197555 48/167 (29%)
Rab 10..172 CDD:206640 48/163 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.