DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and Rab4

DIOPT Version :9

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster


Alignment Length:160 Identity:59/160 - (36%)
Similarity:87/160 - (54%) Gaps:5/160 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVRIMLWDTAGQEEFDCIT 103
            |.:|:|:.|.|||.::..:.:..|..|...||||:|..|.:.:.|:.|::.:|||||||.|..:|
  Fly    10 KFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTAGQERFRSVT 74

  Fly   104 KAYYRGAQASVLVFSTTDRASFDAIKDWKRKVENECN-EIPTVIVQNKIDLIEQAVVTADEVETL 167
            ::|||||..::||:..|.|.||:|:.:|........: .|..::|.||.||.|...||..|..|.
  Fly    75 RSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARDVTFLEASTF 139

  Fly   168 AKLLNCRLIRTSVKEDINVASVFRYLATKC 197
            |:......:.||.|...||...|    .||
  Fly   140 AQENELIFLETSAKTGENVEEAF----LKC 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Ras 50..199 CDD:278499 54/149 (36%)
Rab23_like 50..197 CDD:133306 52/147 (35%)
Rab4NP_523777.1 Rab4 9..169 CDD:206696 59/160 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454424
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.