DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and Rab23

DIOPT Version :9

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001102475.1 Gene:Rab23 / 367242 RGDID:1306867 Length:237 Species:Rattus norvegicus


Alignment Length:248 Identity:139/248 - (56%)
Similarity:172/248 - (69%) Gaps:21/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 MREDDIELAIKVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVRIMLWDT 93
            |.|:|:|:|||:|:||||.||||||||||||||||||||||||||||||||:::.||||:|||||
  Rat     1 MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDT 65

  Fly    94 AGQEEFDCITKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVENECNEIPTVIVQNKIDLIEQAV 158
            |||||||.|||||||||||.|||||||||.||:||..|:.||..|..:|||.:|||||||::.:.
  Rat    66 AGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAISSWREKVVAEVGDIPTALVQNKIDLLDDSC 130

  Fly   159 VTADEVETLAKLLNCRLIRTSVKEDINVASVFRYLATKCHQLMTQSYDQVAGNQQNSSHPPYSST 223
            :..:|.|.|||.|..|..|||||||:||..||:|||.|..|.:.|   |||...:.:    :||:
  Rat   131 IKNEEAEGLAKRLKLRFYRTSVKEDLNVNEVFKYLAEKHLQKLKQ---QVADEPEQT----HSSS 188

  Fly   224 PTISAFSPTF-----TKSSS---GTIV-LRPAKKGHGSSVARKRKIVLKKCGI 267
            ..|..|:.:.     ..|||   |.:: |||.|:.     .:|.:.....|.:
  Rat   189 NKIGVFNASVGSHLGQNSSSLNGGDVINLRPNKQR-----TKKTRNPFSSCSV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Ras 50..199 CDD:278499 106/148 (72%)
Rab23_like 50..197 CDD:133306 105/146 (72%)
Rab23NP_001102475.1 Rab23_like 10..169 CDD:133306 114/158 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347724
Domainoid 1 1.000 234 1.000 Domainoid score I2313
eggNOG 1 0.900 - - E1_KOG4252
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7503
Inparanoid 1 1.050 248 1.000 Inparanoid score I3164
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 1 1.000 - - FOG0008376
OrthoInspector 1 1.000 - - oto96223
orthoMCL 1 0.900 - - OOG6_105709
Panther 1 1.100 - - LDO PTHR24073
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6363
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.760

Return to query results.
Submit another query.