DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and Rab32

DIOPT Version :9

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster


Alignment Length:173 Identity:59/173 - (34%)
Similarity:95/173 - (54%) Gaps:8/173 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DDIELAIKVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGED-VRIMLWDTAG 95
            |..|...|::::|..|.||:|.|:||....|:::|:.||||||..:.::.|... ||:.|||.||
  Fly   478 DKREHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAG 542

  Fly    96 QEEFDCITKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVENEC-----NEIPTVIVQNKIDLIE 155
            ||.|..:|:.||:.|..:.:||..|...:||.:..||..::::.     :.||.:::.||.|..:
  Fly   543 QERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEK 607

  Fly   156 QAVVTADEV--ETLAKLLNCRLIRTSVKEDINVASVFRYLATK 196
            |.::|..|.  |.:.:........||.||:||:....|.|..|
  Fly   608 QGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNK 650

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Ras 50..199 CDD:278499 53/155 (34%)
Rab23_like 50..197 CDD:133306 53/155 (34%)
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 57/167 (34%)
RAB 484..652 CDD:197555 57/167 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454421
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.