DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and Rab9

DIOPT Version :9

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster


Alignment Length:171 Identity:57/171 - (33%)
Similarity:96/171 - (56%) Gaps:8/171 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TSMREDDIELAIKVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVRIMLW 91
            |:||.......:||||:|:||||||:::.|:....:.::...||||:|:.:.|.:|||...:.:|
  Fly     2 TNMRPPQKSKLLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIW 66

  Fly    92 DTAGQEEFDCITKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVEN----ECNEIPTVIVQNKID 152
            ||||||.|..:...:|||:...:|.::..||.|...:..|:.:..|    :.::.|.::|.||.|
  Fly    67 DTAGQERFRALRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADVDQDKFPFIVVGNKND 131

  Fly   153 L-IEQAVVTADEVE--TLAKLLNCRLIRTSVKEDINVASVF 190
            : .::..|::|.|:  ...:.:.|. |.||.|...||...|
  Fly   132 IPAQKRQVSSDAVQQWCAEQKVACH-IETSSKAATNVTDAF 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Ras 50..199 CDD:278499 45/148 (30%)
Rab23_like 50..197 CDD:133306 45/148 (30%)
Rab9NP_609966.1 Rab9 8..178 CDD:206697 54/165 (33%)
Ras 14..177 CDD:278499 54/159 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454420
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.