DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and Rab6

DIOPT Version :9

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster


Alignment Length:202 Identity:66/202 - (32%)
Similarity:99/202 - (49%) Gaps:12/202 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVRIMLWDTAGQEEFDCIT 103
            |:|.:|...|||:|:|.|:....|...|:.|||:|||.:.:.::...||:.||||||||.|..:.
  Fly    14 KLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLI 78

  Fly   104 KAYYRGAQASVLVFSTTDRASFDAIKDWKRKVENE-CNEIPTVIVQNKIDLIEQAVVTADEVETL 167
            .:|.|.:..:|:|:..|:..||.....|...|..| .:::..::|.||.||.::..|:.:|.|..
  Fly    79 PSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSDKRQVSTEEGERK 143

  Fly   168 AKLLNCRLIRTSVKEDINVASVFRYLATKCHQLMTQSYDQVAGNQQNSSHPPYSSTPTISAFSPT 232
            ||.||...|.||.|...||..:||.:|.           .:.|.....:.|.......:...||.
  Fly   144 AKELNVMFIETSAKAGYNVKQLFRRVAA-----------ALPGMDSTENKPSEDMQEVVLKDSPN 197

  Fly   233 FTKSSSG 239
            .||...|
  Fly   198 ETKDPEG 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Ras 50..199 CDD:278499 54/149 (36%)
Rab23_like 50..197 CDD:133306 54/147 (37%)
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 59/169 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454175
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.