DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and Rab30

DIOPT Version :9

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001245926.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster


Alignment Length:227 Identity:74/227 - (32%)
Similarity:127/227 - (55%) Gaps:28/227 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DDIELAIKVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVRIMLWDTAGQ 96
            :|.:...|:|:|||.||||:.:::|:.:|:|......||||||:.:.:|::||.:::.:||||||
  Fly     2 EDYKFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQIWDTAGQ 66

  Fly    97 EEFDCITKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVENECN-EIPTVIVQNKIDLIEQAVVT 160
            |.|..||::|||.|.|.:||:..:.:.:||.:.||.|:::...| ::..::|.||.|..::.:.|
  Fly    67 ERFRSITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGNKTDRDDREIPT 131

  Fly   161 ADEV-ETLAKLLNCRLIRTSVKEDINVASVFRYLATKCHQLMTQSYDQVAGNQQNSSHPPYSSTP 224
              :: |..||..:...:.||.||..||..:|..:|.   :|:.|     |.::..||        
  Fly   132 --QIGEEFAKQHDMYFLETSAKEAENVERLFYEIAA---ELIGQ-----ARSKDGSS-------- 178

  Fly   225 TISAFSPTFTKSSSGTIVLRPAKKGHGSSVAR 256
              ||.:....:.|.|:.:      |.||..|:
  Fly   179 --SAAAAAAQRQSEGSSI------GLGSFSAK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Ras 50..199 CDD:278499 52/150 (35%)
Rab23_like 50..197 CDD:133306 52/148 (35%)
Rab30NP_001245926.1 Rab30 1..168 CDD:133314 61/170 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454423
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.