DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and Rab21

DIOPT Version :9

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster


Alignment Length:174 Identity:66/174 - (37%)
Similarity:98/174 - (56%) Gaps:6/174 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LAIKVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEI-DGEDVRIMLWDTAGQEEF 99
            |..|.|::|.|.|||:|::.||.:..|...:..|:...|:.|::.: ||...::.:|||||||.|
  Fly    12 LNFKAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQERF 76

  Fly   100 DCITKAYYRGAQASVLVFSTTDRASFDAIKDWKRKV-ENECNEIPTVIVQNKIDLIEQAVVTADE 163
            ..:...||||:..::||:..|||.||..:|.|.|:: :....||..:||.||.||.||..||.||
  Fly    77 HALGPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALIIVGNKTDLEEQRAVTHDE 141

  Fly   164 VETLAKLLNCRLIRTSVKEDINVASVFRYLATKCHQLMTQSYDQ 207
            ....|:.:..:.:.||.||:..||.:|..|.    |||.:...|
  Fly   142 ALQYARTVGAQYVETSAKENEGVAELFELLT----QLMLEQLSQ 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Ras 50..199 CDD:278499 55/150 (37%)
Rab23_like 50..197 CDD:133306 55/148 (37%)
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 63/165 (38%)
Ras 15..177 CDD:278499 64/165 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454417
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.