DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and CG4789

DIOPT Version :9

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_573166.1 Gene:CG4789 / 32668 FlyBaseID:FBgn0030792 Length:274 Species:Drosophila melanogaster


Alignment Length:287 Identity:48/287 - (16%)
Similarity:94/287 - (32%) Gaps:107/287 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IKVVIVGNGGVGKSSM--IQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVR----------IML 90
            :::|:||:.||||:|:  :..:.:.:....:  |:|.:     |::.....|          :.|
  Fly     7 VRIVVVGDSGVGKTSLTHLITHNEALIRPGW--TVGCN-----IQVKMHPFREGTARECPYFVEL 64

  Fly    91 WDTAGQEEFDCITKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVENE----------------- 138
            :|..|..........:|.|....:||...|:..|...:.||..::.|:                 
  Fly    65 FDVGGSLNHKNTRSVFYAGIDGIILVHDLTNAKSQRQLIDWLYEIVNKEGKDTNKSNGASMPPSP 129

  Fly   139 ---------------------------CNEIPTVIVQNKIDLIEQA---------------VVTA 161
                                       ..:.|.:::..|:||:::.               ...|
  Fly   130 PSPLSSFSTDNLGTDGHILFDMEEFLGATQTPILVMGTKLDLLDEKRHPKMGVKKPGGIADKCGA 194

  Fly   162 DEVETLAKLLNCRLIRTSVKEDINVASVFRYLATKCHQLMTQSYDQVAGNQQ----------NSS 216
            :|:     .||||..|:......:...:.|:            :|:|..|::          :||
  Fly   195 EEI-----WLNCRNSRSLAAGTTDAVKLSRF------------FDRVIENRKALRAALAFGVSSS 242

  Fly   217 HPPYSSTPTISAFSPTFTKSSSGTIVL 243
            :.  .|.|....|.||..|.....:.|
  Fly   243 NA--VSPPDRRRFGPTSAKMEDSVLPL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Ras 50..199 CDD:278499 30/219 (14%)
Rab23_like 50..197 CDD:133306 30/217 (14%)
CG4789NP_573166.1 P-loop_NTPase 7..228 CDD:304359 38/244 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454419
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.