DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and Rab9Db

DIOPT Version :9

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_572642.1 Gene:Rab9Db / 31993 FlyBaseID:FBgn0030221 Length:197 Species:Drosophila melanogaster


Alignment Length:190 Identity:50/190 - (26%)
Similarity:88/190 - (46%) Gaps:19/190 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVR----IMLWDTAGQEEF 99
            |::|:|:.||||:.::.|:....||:.::.|:|:|  .|:..::..|.|    :.:|||:..|.|
  Fly     9 KIIILGDSGVGKTCLLMRFSDNQFTERHRVTVGMD--RRECSVEFADWRMGRMLQVWDTSDDERF 71

  Fly   100 DCITKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVENEC-NEIPTVIVQNKIDLIEQAVVTADE 163
            ..:.....|.|...:||:..|...||..|..|.:::...| :::..::|.||.|......|:..:
  Fly    72 KLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSDDPNHRQVSMAQ 136

  Fly   164 VETLAKLLNCRLIRTSVKEDINVASVFRYLATKCHQLMTQSYDQVAGNQQNSSHPPYSST 223
            ....|...:......|.|...||..:|..||...:     :|.:|..|       |:|.|
  Fly   137 GFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDIY-----TYRRVHYN-------PFSLT 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Ras 50..199 CDD:278499 38/153 (25%)
Rab23_like 50..197 CDD:133306 38/151 (25%)
Rab9DbNP_572642.1 RAB 8..171 CDD:197555 44/163 (27%)
Rab 8..167 CDD:206640 42/159 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454278
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.