DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and RabX2

DIOPT Version :9

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster


Alignment Length:189 Identity:51/189 - (26%)
Similarity:90/189 - (47%) Gaps:16/189 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVRIMLWDTAGQEEFDCIT 103
            ||:::|:.|||||.::.|:....||:.|.:|:|:|...|.:|:....:.:.:|||:|.:.|:.:.
  Fly     9 KVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDKRFNSLM 73

  Fly   104 KAYYRGAQASVLVFSTTDRASFDAIKDWKRKVENEC-NEIPTVIVQNKIDLIEQAVVTADEVETL 167
            .:.||.|...:||:..|...||..|..|.:::...| :::..::|.||.|......|:.::....
  Fly    74 PSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSMEQGFNY 138

  Fly   168 AKLLNCRLIRTSVKEDINVASVFRYLATKC-HQLMTQSYDQVAGNQQNSSHPPYSSTPT 225
            |..........|.|..:||..:|..||... |:.:.              |.|.|..|:
  Fly   139 AHRGALGFEEVSAKSGMNVYDIFSSLAMDIYHRYVL--------------HNPISPMPS 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Ras 50..199 CDD:278499 40/150 (27%)
Rab23_like 50..197 CDD:133306 40/147 (27%)
RabX2NP_572627.1 RAB 8..171 CDD:197555 46/161 (29%)
Rab 8..165 CDD:206640 44/155 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454279
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.