DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and Rab23

DIOPT Version :9

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001153201.1 Gene:Rab23 / 19335 MGIID:99833 Length:237 Species:Mus musculus


Alignment Length:229 Identity:135/229 - (58%)
Similarity:168/229 - (73%) Gaps:16/229 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 MREDDIELAIKVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVRIMLWDT 93
            |.|:|:|:|||:|:||||.||||||||||||||||||||||||||||||||:::.||||:|||||
Mouse     1 MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDT 65

  Fly    94 AGQEEFDCITKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVENECNEIPTVIVQNKIDLIEQAV 158
            |||||||.|||||||||||.|||||||||.||:||..|:.||..|..:|||.:|||||||::.:.
Mouse    66 AGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAISSWREKVVAEVGDIPTALVQNKIDLLDDSC 130

  Fly   159 VTADEVETLAKLLNCRLIRTSVKEDINVASVFRYLATKCHQLMTQSYDQVAGNQQNSSHPPYSST 223
            :..:|.|.|||.|..|..|||||||:||:.||:|||.|..|.:.|   |:..:.:.:    :||:
Mouse   131 IKNEEAEGLAKRLKLRFYRTSVKEDLNVSEVFKYLAEKHLQKLKQ---QITEDPEQT----HSSS 188

  Fly   224 PTISAFSPTF-----TKSSS---GTIV-LRPAKK 248
            ..|..|:.:.     ..|||   |.:: |||.|:
Mouse   189 NKIGVFNASVRSHLGQNSSSLNGGDVINLRPNKQ 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Ras 50..199 CDD:278499 106/148 (72%)
Rab23_like 50..197 CDD:133306 105/146 (72%)
Rab23NP_001153201.1 Rab23_like 10..169 CDD:133306 114/158 (72%)
Effector region. /evidence=ECO:0000250 38..46 7/7 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..237 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844356
Domainoid 1 1.000 235 1.000 Domainoid score I2359
eggNOG 1 0.900 - - E1_KOG4252
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7503
Inparanoid 1 1.050 250 1.000 Inparanoid score I3217
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 1 1.000 - - FOG0008376
OrthoInspector 1 1.000 - - oto92661
orthoMCL 1 0.900 - - OOG6_105709
Panther 1 1.100 - - LDO PTHR24073
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5549
SonicParanoid 1 1.000 - - X6363
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.