DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and Rab20

DIOPT Version :9

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_035357.1 Gene:Rab20 / 19332 MGIID:102789 Length:233 Species:Mus musculus


Alignment Length:205 Identity:55/205 - (26%)
Similarity:84/205 - (40%) Gaps:49/205 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 MREDDIELAIKVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVRIMLWDT 93
            ||:.|    .|:|::|:..|||:|::|||.:..| .|...|:|..|..:|    .....|.:|||
Mouse     1 MRKPD----GKIVLLGDMNVGKTSLLQRYMERRF-PDTVSTVGGAFYLKQ----WRSFNISIWDT 56

  Fly    94 AGQEEFDCITKAYYRGAQASVLVFSTTDRASFDAIKD-WKRKVENECNEIPTVIVQNKIDL---- 153
            ||:|:|..:...|.|||.|.:|.:......|...::| :....|...|:....||.||:||    
Mouse    57 AGREQFHGLGSLYCRGAAAIILTYDVNHPQSLFELEDRFLGLTETANNDCLFAIVGNKVDLTSER 121

  Fly   154 ----------------------IEQAVVTADEVETLAKLLNCRLI-------------RTSVKED 183
                                  :.:.|...|.|....|:|..:::             .||.|..
Mouse   122 DTEGGEKEGPASGKVGSCVSTKVPKQVQPEDAVALYKKILKYKMLDEREMPAAEQMCFETSAKTG 186

  Fly   184 INVASVFRYL 193
            .||..:|..|
Mouse   187 YNVDLLFETL 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Ras 50..199 CDD:278499 47/184 (26%)
Rab23_like 50..197 CDD:133306 47/184 (26%)
Rab20NP_035357.1 Rab20 7..232 CDD:133326 52/195 (27%)
Ras 7..196 CDD:278499 51/193 (26%)
Effector region. /evidence=ECO:0000250 33..41 2/7 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..138 0/18 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.