Sequence 1: | NP_649574.1 | Gene: | Rab23 / 40701 | FlyBaseID: | FBgn0037364 | Length: | 268 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_035357.1 | Gene: | Rab20 / 19332 | MGIID: | 102789 | Length: | 233 | Species: | Mus musculus |
Alignment Length: | 205 | Identity: | 55/205 - (26%) |
---|---|---|---|
Similarity: | 84/205 - (40%) | Gaps: | 49/205 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 MREDDIELAIKVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVRIMLWDT 93
Fly 94 AGQEEFDCITKAYYRGAQASVLVFSTTDRASFDAIKD-WKRKVENECNEIPTVIVQNKIDL---- 153
Fly 154 ----------------------IEQAVVTADEVETLAKLLNCRLI-------------RTSVKED 183
Fly 184 INVASVFRYL 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab23 | NP_649574.1 | Ras | 50..199 | CDD:278499 | 47/184 (26%) |
Rab23_like | 50..197 | CDD:133306 | 47/184 (26%) | ||
Rab20 | NP_035357.1 | Rab20 | 7..232 | CDD:133326 | 52/195 (27%) |
Ras | 7..196 | CDD:278499 | 51/193 (26%) | ||
Effector region. /evidence=ECO:0000250 | 33..41 | 2/7 (29%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 119..138 | 0/18 (0%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1340129at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |