DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and rab-33

DIOPT Version :9

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_499314.1 Gene:rab-33 / 176470 WormBaseID:WBGene00004283 Length:307 Species:Caenorhabditis elegans


Alignment Length:214 Identity:74/214 - (34%)
Similarity:103/214 - (48%) Gaps:19/214 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QTATGGAAASVLQTHSQAQYNYTSMREDDIELAIKVVIVGNGGVGKSSMIQRYCKGIFTKDYKKT 69
            :..|.|.....|...|...|..        :...||:||||..|||:.:..|:|.|.|.:..:.|
 Worm    76 EAVTAGPKKMALAPSSTKTYKQ--------KRTFKVIIVGNAAVGKTCLSFRFCCGRFPEHTEAT 132

  Fly    70 IGVDFLERQIEIDGEDVRIMLWDTAGQEEF-DCITKAYYRGAQASVLVFSTTDRASFDAIKDWKR 133
            |||||.||...|:.|.:|:.||||||||.: ..|...|||...|.|.|:..|.|.||:.:..|.:
 Worm   133 IGVDFRERSCVIENELLRVQLWDTAGQERYRQSIVAHYYRNVNAVVFVYDVTCRESFNDLALWIK 197

  Fly   134 KVENE----CNEIPTVIVQNKIDLIEQAVVTADEVETLAKLLNCRLIRTSVK---EDINVASVFR 191
            :.|..    .:|:|.:::.||.|:.....|:.||.:..|...|..|..||.|   |..:|.|:|.
 Worm   198 ECEKHGLVGDSEVPRILIGNKCDVECTNRVSTDEAQMFADRNNMALFETSAKLASEADHVESIFL 262

  Fly   192 YLATKCHQ---LMTQSYDQ 207
            .|..|..|   :..||.|:
 Worm   263 TLLHKLQQSKPMHVQSQDE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Ras 50..199 CDD:278499 57/156 (37%)
Rab23_like 50..197 CDD:133306 56/154 (36%)
rab-33NP_499314.1 Rab33B_Rab33A 99..270 CDD:133315 65/170 (38%)
RAB 101..270 CDD:197555 65/168 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.