DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and ZK669.5

DIOPT Version :9

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001040832.1 Gene:ZK669.5 / 174280 WormBaseID:WBGene00014055 Length:212 Species:Caenorhabditis elegans


Alignment Length:222 Identity:63/222 - (28%)
Similarity:98/222 - (44%) Gaps:41/222 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVRI-----MLWDTAGQEE 98
            |.:|.|...|||.::::.:|    |:...::|..     .:.:|.|.|.|     ..|:....:|
 Worm    13 KFLIFGGKSVGKKTLLRSFC----TEGDNESIWT-----SLTVDDEKVLIEATVSQKWEEGMSKE 68

  Fly    99 FDCITKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVENECNEIPTVIVQNKIDLIEQAVVTADE 163
            .|.|           .|||||||..||:...:...:::.....||.|.::||||::|.:.:....
 Worm    69 HDAI-----------ALVFSTTDVYSFEYTLELYNEIQKSTERIPLVFIENKIDIVEDSQMDKGL 122

  Fly   164 VETLAKLLNCRLIRTSVKEDINVASVFRYLATKCHQLMTQSYDQVAGNQQNSSHPPYSST----P 224
            ||...:..:.||.|.|..::.||...|.||..|   |..|..|..|..::.||....:||    .
 Worm   123 VEGEMRKKHKRLYRVSALKEFNVMHPFAYLIEK---LTRQKKDLNANERKQSSSVNSTSTSPPST 184

  Fly   225 TISAF---SPTFTKSSSGTIVLRPAKK 248
            |:.|:   .||.|.:|:      ||.|
 Worm   185 TVEAWVEPVPTATTTSA------PALK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Ras 50..199 CDD:278499 41/153 (27%)
Rab23_like 50..197 CDD:133306 40/151 (26%)
ZK669.5NP_001040832.1 RAB 12..145 CDD:197555 40/151 (26%)
P-loop_NTPase 13..155 CDD:304359 45/161 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.