DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab23 and rab-5

DIOPT Version :9

Sequence 1:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_492481.1 Gene:rab-5 / 172755 WormBaseID:WBGene00004268 Length:208 Species:Caenorhabditis elegans


Alignment Length:161 Identity:53/161 - (32%)
Similarity:93/161 - (57%) Gaps:5/161 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVRIMLWDTAGQEEFDCIT 103
            |:|::|...|||||::.|:.||.|.:..:.|||..||.:.:.:|...::..:|||||||.:..:.
 Worm    21 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDATIKFEIWDTAGQERYHSLA 85

  Fly   104 KAYYRGAQASVLVFSTTDRASFDAIKDWKRKVENECNEIPTVIVQ---NKIDLIEQAVVTADEVE 165
            ..|||||||:::|:..|::.||...|:|.::::.:.:  |.:::.   ||.|:..:..|..:|..
 Worm    86 PMYYRGAQAAIVVYDITNQESFQKAKNWVKELQRQAS--PNIVMALAGNKADVANKRTVEYEEAN 148

  Fly   166 TLAKLLNCRLIRTSVKEDINVASVFRYLATK 196
            ..|:......:.||.|..:||..:|..:|.|
 Worm   149 AYAEDNALLFMETSAKTSMNVNDIFMAIAKK 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab23NP_649574.1 Ras 50..199 CDD:278499 48/150 (32%)
Rab23_like 50..197 CDD:133306 48/150 (32%)
rab-5NP_492481.1 Rab5_related 19..181 CDD:206653 53/161 (33%)
Ras 21..181 CDD:278499 53/161 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.