DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARR3 and Arr1

DIOPT Version :9

Sequence 1:XP_016885007.1 Gene:ARR3 / 407 HGNCID:710 Length:403 Species:Homo sapiens
Sequence 2:NP_001246073.1 Gene:Arr1 / 35078 FlyBaseID:FBgn0000120 Length:364 Species:Drosophila melanogaster


Alignment Length:398 Identity:160/398 - (40%)
Similarity:236/398 - (59%) Gaps:42/398 - (10%)


- Green bases have known domain annotations that are detailed below.


Human     3 KVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIGEFFLTKVLSVLLSTDGVVLVDPEYLK-CRKLFV 66
            |||||.|.|..:::|:.:|||||.|..||||               ||::::|.||:: .||:||
  Fly     6 KVFKKCSPNNMITLYMNRRDFVDSVTQVEPI---------------DGIIVLDDEYVRQNRKIFV 55

Human    67 MLTCAFRYGRDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQM 131
            .|.|.|||||:|.|:|||.|:|:|.:.:.||.|.:....|  ||.:|||||.|||.|||||.:||
  Fly    56 QLVCNFRYGREDDEMIGLRFQKELTLVSQQVCPPQKQDIQ--LTKMQERLLKKLGSNAYPFVMQM 118

Human   132 VTNLPCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPSA 196
            ..:.|.||.||....|..:|||:.:.||.|..::..:...:|..:.|.:||||:||.:.|..|..
  Fly   119 PPSSPASVVLQQKASDESQPCGVQYFVKIFTGDSDCDRSHRRSTINLGIRKVQYAPTKQGIQPCT 183

Human   197 QTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVLYSLDKY 261
            ...:.||||...|:|:..:|:::::|||.||||:.:.|.:|||:||||..|.|..||||:...::
  Fly   184 VVRKDFLLSPGELELEVTLDKQLYHHGEKISVNICVRNNSNKVVKKIKAMVQQGVDVVLFQNGQF 248

Human   262 TKTVFIQEFTETVAAN--SSFSQSFAVTPILAASCQKRGLALDGKLKHEDTNLASSTIIRPGMDK 324
            ..|:...|.:|....|  ||..:...:.|.|.|:|.:.|:|::|.:|.:||.|||:|:|.....:
  Fly   249 RNTIAFMETSEGCPLNPGSSLQKVMYLVPTLVANCDRAGIAVEGDIKRKDTALASTTLIASQDAR 313

Human   325 ELLGILVSYKVRVNLMVSCGGILGDLTASDVGVELPLVLIHPKPSHEAASSEDIVIEEFTRKGEE 389
            :..||:|||.|:|.|.:  |.:.|:|.|     |||.:|:|||||               ||.:.
  Fly   314 DAFGIIVSYAVKVKLFL--GALGGELCA-----ELPFILMHPKPS---------------RKAQL 356

Human   390 ESQKAVEA 397
            |::.::||
  Fly   357 EAEGSIEA 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARR3XP_016885007.1 None
Arr1NP_001246073.1 Arrestin_N 17..173 CDD:304627 74/172 (43%)
Arrestin_C 192..350 CDD:214976 64/164 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3865
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52566
OrthoDB 1 1.010 - - D340461at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.