DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xe7 and ZCW7

DIOPT Version :9

Sequence 1:NP_730984.1 Gene:Xe7 / 40699 FlyBaseID:FBgn0010772 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_564748.1 Gene:ZCW7 / 842250 AraportID:AT1G59600 Length:324 Species:Arabidopsis thaliana


Alignment Length:171 Identity:50/171 - (29%)
Similarity:77/171 - (45%) Gaps:27/171 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LDERKRLRAAIQRLDGISLRISGFSESFRVRCAESKDDFPTRHDWDSYFRDARNMDEMKAGER-P 145
            ||.||.|   :::::||.|.:.|......|....|.|....:.||:.::.    ....:.|.| .
plant   124 LDWRKSL---VEKMNGIELNLEGVKYKLSVVLPISDDFEKLKKDWEEFYA----FGHSREGRREA 181

  Fly   146 DTIHISHLPMRWFC-PRHSEHEENVKPSENIFKRIFEKFGRVRMVDIPICDPYRKSMQAD----I 205
            |||.:..:|.|||. ||.|.     |||..:...||..||::|.:::...|...|....|    |
plant   182 DTIILRGVPSRWFAEPRVSS-----KPSMLVTHTIFSSFGKIRNLNVAEDDDLGKDADEDSGDLI 241

  Fly   206 NGMRTFSFEQDVLFEGYVQFEEYSSFVRAMDEFRGNKLVRK 246
            :|:..         :..||||:|:.||.||..|.|..:.::
plant   242 SGLHC---------KIVVQFEKYNDFVNAMKAFCGRSMEKE 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Xe7NP_730984.1 RRM_AKAP17A 142..268 CDD:240710 36/111 (32%)
GBP_C <275..387 CDD:303769
coiled coil 356..367 CDD:293879
coiled coil 376..387 CDD:293879
ZCW7NP_564748.1 RRM_AKAP17A 178..293 CDD:240710 35/110 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2891
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004994
OrthoInspector 1 1.000 - - oto3311
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12484
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.