DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr33 and wdr77

DIOPT Version :9

Sequence 1:NP_730982.1 Gene:Wdr33 / 40698 FlyBaseID:FBgn0046222 Length:807 Species:Drosophila melanogaster
Sequence 2:NP_001120009.1 Gene:wdr77 / 100144971 XenbaseID:XB-GENE-972898 Length:333 Species:Xenopus tropicalis


Alignment Length:287 Identity:61/287 - (21%)
Similarity:117/287 - (40%) Gaps:50/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 PPSAYLDNPSNAVTTRFVKTATNKMRCPIFTLAWTPEGRRLVTGASSGEFTLWNGLTFNFETIL- 184
            |.||    |:.::.|..|:|...     :..:||..| :.::..:.||...||..|  ..|::| 
 Frog    54 PDSA----PNESLCTAGVQTEAG-----VTDVAWVSE-KGILVASDSGAVELWEIL--EKESLLV 106

  Fly   185 -----QAHDISVRTMVWSHNDSWMVTGDHGGYVKYWQSNMNN-VKMYQAHKEAIRGISFSP-TDS 242
                 ..||..|:::....:.:..|:|.....||.|...... :..|.||...:..::..| .::
 Frog   107 NKFTKYEHDDIVKSLSVFSDGTQAVSGGKDFSVKVWDLTQKTLLNSYIAHSSEVNCVAACPGKEA 171

  Fly   243 KFVSGSDDGTLRIWDFMRCQEERVLRGHGADV--KCVHWHPQK----------GMIVSGSKDNQQ 295
            .|:|..:||.:.:||..:.:....:.....|.  ..|.|||:|          |.:...:..|..
 Frog   172 IFLSCGEDGKILLWDTRKPKPATRIDFFTPDTIPTSVTWHPEKDDTFACGDEIGNVYLVNLKNLD 236

  Fly   296 PIKIWDPKSGIALATLHAHKSTVMDLKWNDNGN-WLVTASRDHLLKLFDIRNLREEVQVFR--GH 357
            .::    ||.:       |..::..|.::.:.: :|.:.|.|..:.::|    .:..:.||  .|
 Frog   237 SVQ----KSSV-------HSQSITGLAYSYHSSPYLASISEDCTVAVYD----SDFSEAFRDLSH 286

  Fly   358 KKEASSVSWHPIHEGLFCSGGSDGSIL 384
            :...:.|:|.|:....|.:.|.|..:|
 Frog   287 RDFVTGVAWSPLDHSKFTTVGWDHKVL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr33NP_730982.1 WD40 146..429 CDD:238121 54/262 (21%)
WD40 148..>432 CDD:225201 54/260 (21%)
WD40 repeat 149..186 CDD:293791 10/42 (24%)
WD40 repeat 192..227 CDD:293791 6/35 (17%)
WD40 repeat 232..268 CDD:293791 7/36 (19%)
WD40 repeat 275..312 CDD:293791 9/46 (20%)
WD40 repeat 318..355 CDD:293791 5/37 (14%)
WD40 repeat 362..398 CDD:293791 7/23 (30%)
WD40 repeat 405..429 CDD:293791
wdr77NP_001120009.1 WD40 <43..312 CDD:225201 60/284 (21%)
WD40 70..>297 CDD:295369 49/249 (20%)
WD40 repeat 73..110 CDD:293791 10/39 (26%)
WD40 repeat 119..154 CDD:293791 5/34 (15%)
WD40 repeat 160..197 CDD:293791 7/36 (19%)
WD40 repeat 205..242 CDD:293791 8/40 (20%)
WD40 repeat 248..273 CDD:293791 4/24 (17%)
WD40 repeat 290..312 CDD:293791 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.