DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED27 and MED27

DIOPT Version :9

Sequence 1:NP_649569.1 Gene:MED27 / 40696 FlyBaseID:FBgn0037359 Length:293 Species:Drosophila melanogaster
Sequence 2:XP_016870818.1 Gene:MED27 / 9442 HGNCID:2377 Length:341 Species:Homo sapiens


Alignment Length:330 Identity:118/330 - (35%)
Similarity:186/330 - (56%) Gaps:39/330 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKLNSTLTAVKNLRSNVRLCFEHLADGTDGESGEESRNK-FVNDFQERFAAINSQIREVEQLIN 64
            ::..:..::|::.|||:|...|:.|.||...:...|.|.| |:..||:...::|..:.|:|:|.|
Human    11 LEAFSQAISAIQALRSSVSRVFDCLKDGMRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSN 75

  Fly    65 GLPVPPTPYSLGNTAYLAQETSQDRQALYPQLVNSYKWMDKVHDHSFLAFNNLNQNTLRRSYNYC 129
            .:..|...:.|.|:..|:.:..||:..||.||:.:|||.:|:..|:.||...|||.:|:||.|..
Human    76 LVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASGLLNQQSLKRSANQM 140

  Fly   130 SQKRQRLPFSSFNN---DPDHIDKLLSEINTP-PHTSYRIFRPFGTNAVTIVTISNVMKAAIVFK 190
            ....:|.|.:....   .|.::|.::|.|:.. |..|..:.||.||:|:.:||:..|:|..:|.:
Human   141 GVSAKRRPKAQPTTLVLPPQYVDDVISRIDRMFPEMSIHLSRPNGTSAMLLVTLGKVLKVIVVMR 205

  Fly   191 GVLIEWVTVKGFDE----------------------PLEHD------------DLWAESRYEVFR 221
            .:.|:...|||::|                      .|..|            |:|::|.|:||:
Human   206 SLFIDRTIVKGYNENVYTEDGKFFLCVKRSFDVLVFALRTDVSVLKQLVICKLDIWSKSNYQVFQ 270

  Fly   222 KVQDHAHSAMLHFFSPTLPDLAVKSYITWLNSHVKLFLEPCKRCGKFVVNGLPPTWRDLRTLEPF 286
            ||.|||.:|:||:..|.:||:.|:|::|||.|::|||..||:|||||:.:||||||||.||||.|
Human   271 KVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQAPCQRCGKFLQDGLPPTWRDFRTLEAF 335

  Fly   287 HEDCR 291
            |:.||
Human   336 HDTCR 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED27NP_649569.1 Med27 209..287 CDD:288428 46/89 (52%)
MED27XP_016870818.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156874
Domainoid 1 1.000 124 1.000 Domainoid score I5561
eggNOG 1 0.900 - - E1_28JSR
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3152
Inparanoid 1 1.050 229 1.000 Inparanoid score I3463
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48630
OrthoDB 1 1.010 - - D1256412at2759
OrthoFinder 1 1.000 - - FOG0007494
OrthoInspector 1 1.000 - - oto91564
orthoMCL 1 0.900 - - OOG6_107387
Panther 1 1.100 - - LDO PTHR13130
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4648
SonicParanoid 1 1.000 - - X6375
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.