DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED27 and AT3G09180

DIOPT Version :9

Sequence 1:NP_649569.1 Gene:MED27 / 40696 FlyBaseID:FBgn0037359 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001325465.1 Gene:AT3G09180 / 820074 AraportID:AT3G09180 Length:402 Species:Arabidopsis thaliana


Alignment Length:330 Identity:70/330 - (21%)
Similarity:115/330 - (34%) Gaps:118/330 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNSTLTAVKNLRSNVRLCFEHLADGTDGESGEESRNKFVNDFQERFAAINSQIREVEQLINGLPV 68
            ::.|..|:|......|..|.|:.||...|...:..                  |....|:.....
plant   143 VDRTRLALKAFTDQKRRFFPHIDDGLKMEPSSKKH------------------RASHLLLENGRE 189

  Fly    69 PPTPYSLGNTAYLAQETSQDRQALYPQLVNSYKWMDKVHDHSFLAFNNLNQNTLRRSYNYCSQKR 133
            .|..|          :|..|.|:...:||.|.    ||..:..|       |.|:|:        
plant   190 EPVDY----------KTLPDIQSRLEKLVPSV----KVSTYGRL-------NWLKRA-------- 225

  Fly   134 QRLPFSSFNNDP--------------------DHIDKL-LSEINTPPHTSYRIFRPFGTNAVTIV 177
            ..|| .|.::||                    :.:||: :.|::.|     .:||       .||
plant   226 NSLP-GSGSDDPTEASKPIFQSSSKLRSGLQTEVVDKIAVIELSFP-----SLFR-------AIV 277

  Fly   178 TIS---NVMKAAIVF----KGVLIEWVTVKGFDEPLEHDDLWAESRYEVFRKVQDHAHSAMLHFF 235
            ::|   :|...|:.|    :|.  .::..:||            |.|.|::.:.:||.:| |.:|
plant   278 SLSPAGSVDPDAVAFFSPDEGG--SYLHARGF------------SVYHVYKHITEHAATA-LQYF 327

  Fly   236 SPTLPDLAVKSYITWLNSHVKLFLEPCKRCGKFVVNG------LPPTWR---------DLRTLEP 285
            .......|:.|.:.|:.|...:|.:||.:||:.:...      |||..|         :|...|.
plant   328 LGFGTGTALYSLLLWICSFESVFSKPCTKCGRLLAMDKKSALILPPLHRAYQELPLALNLDVCEA 392

  Fly   286 FHEDC 290
            :|..|
plant   393 YHSSC 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED27NP_649569.1 Med27 209..287 CDD:288428 23/92 (25%)
AT3G09180NP_001325465.1 Med27 308..397 CDD:402942 24/89 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1256412at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13130
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.