DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED27 and mdt-27

DIOPT Version :9

Sequence 1:NP_649569.1 Gene:MED27 / 40696 FlyBaseID:FBgn0037359 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_505386.2 Gene:mdt-27 / 179303 WormBaseID:WBGene00007023 Length:440 Species:Caenorhabditis elegans


Alignment Length:253 Identity:49/253 - (19%)
Similarity:93/253 - (36%) Gaps:55/253 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 YSLGNTAYLAQETSQ--DRQALYPQLVNSYKWMDKVHDHSFLAFNNLNQNTLRRSYNYCSQKRQR 135
            |.|...|.|....:.  |::.||..:.:|.:.:.:..:.::..|..|.:....|:   ..:|...
 Worm   173 YELNRAAALKCRYNAVFDKRPLYKAVESSIQDLRQKDESAYQLFYKLQEAMDERT---VIEKNII 234

  Fly   136 LPFSSFNNDPDHIDKLLSEINTPPHTSY-------------------------------RIFRPF 169
            ....:|..:..|..: :|.::.||...:                               ||..|.
 Worm   235 AVSETFRQNAVHAPR-VSRLSVPPPLKFSKHVEDANKGVFLAMDAVMNKTRGDLTWRFKRISHPC 298

  Fly   170 GTNAVTIVTIS-------------NVMKAAIVFKGVLIEWVTVKGFDEPLEHDDLWAESRYEVFR 221
            ..|:.:::.:.             ..|||.||.|..::|.:.:.|.||.|.:.:....|:.:|:|
 Worm   299 FRNSKSLIEVHYCARRPNSEKEFVPCMKAVIVLKYGILEDMIIGGEDEDLYNQEQILHSKRKVYR 363

  Fly   222 KVQDHAHSAMLHFFSPTLPDLAVKSYI---TWLNSHVKLFLEPCKRCGKFVVNGLPPT 276
            :....|...:|  .||.....|..::.   .::.|:|..|...|..|.|.:...:|||
 Worm   364 EFTKSAKEIIL--CSPVTKFTAPTNFAQCNNYIQSYVNCFSTKCYYCKKHLRQFMPPT 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED27NP_649569.1 Med27 209..287 CDD:288428 17/71 (24%)
mdt-27NP_505386.2 Med27 351..431 CDD:288428 17/71 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007494
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.