DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and CML23

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_564874.1 Gene:CML23 / 842958 AraportID:AT1G66400 Length:157 Species:Arabidopsis thaliana


Alignment Length:148 Identity:43/148 - (29%)
Similarity:74/148 - (50%) Gaps:13/148 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IERLYSRFTSLDRNDCGTLSREDLMRIPELAINP-LCERIVHSFFAESNDDRVNFRQFMNVLAHF 91
            |::::.||   |:|:.|.:|.::|..:.. |::| ..:....:...|.:.|...|......:|.|
plant    16 IKKVFQRF---DKNNDGKISIDELKDVIG-ALSPNASQEETKAMMKEFDLDGNGFIDLDEFVALF 76

  Fly    92 RPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELLSILHMMVGANISQDQLVSIAERTILE 156
            : :.|  ||..||....||.||.:||||.:|.||.:||.|::     .|:.:...:...:|.|.:
plant    77 Q-ISD--QSSNNSAIRDLKEAFDLYDLDRNGRISANELHSVM-----KNLGEKCSIQDCQRMINK 133

  Fly   157 ADLCCQGKISFEDFCKAL 174
            .|....|.:.||:|.|.:
plant   134 VDSDGDGCVDFEEFKKMM 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 42/145 (29%)
CML23NP_564874.1 PTZ00184 13..152 CDD:185504 43/148 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.