DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and CBL8

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001319319.1 Gene:CBL8 / 842756 AraportID:AT1G64480 Length:214 Species:Arabidopsis thaliana


Alignment Length:186 Identity:50/186 - (26%)
Similarity:89/186 - (47%) Gaps:28/186 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IQEETGFTPNQIERLYSRFTSLDR---NDCGTLSREDLMRIPELAI-------NPLCERIVHSFF 71
            :..||.||.|:||.|:..|..|..   || |.:.:|:.:    ||:       |...:|:.:.|.
plant    25 LASETPFTVNEIEALHDLFKKLSTSIIND-GLIHKEEFL----LALFRNGSMQNLFADRVFYMFD 84

  Fly    72 AESNDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELLSILHMM 136
            .:.| ..:.|.:|:..|:.|.|        .....||..|.||::||...|.|...||..::..:
plant    85 RKRN-GVIEFGEFVRSLSIFHP--------YTPEHEKSAFMFKLFDLHGTGFIEPHELKKMVGAL 140

  Fly   137 VG---ANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRT-DVDQKMSIRFL 188
            :|   ..:|::.:.:|.|:|:||.|....|||..|::.:.:.:. .:.:.|::.:|
plant   141 LGETDLELSEESIEAIVEQTMLEVDTNKDGKIDEEEWKELVAKNPSILKNMTLPYL 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 46/162 (28%)
CBL8NP_001319319.1 FRQ1 29..187 CDD:227455 47/171 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.