DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and CBL2

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001332655.1 Gene:CBL2 / 835697 AraportID:AT5G55990 Length:226 Species:Arabidopsis thaliana


Alignment Length:201 Identity:51/201 - (25%)
Similarity:91/201 - (45%) Gaps:34/201 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRN--DCGTLSREDLMRIPELAI------N 60
            |.|..|.:.|:  :..:|.|:.::||.||..|..:...  |.|.:::|:.    :||:      .
plant    25 KQSGGLGDPEL--LARDTVFSVSEIEALYELFKKISSAVIDDGLINKEEF----QLALFKTNKKE 83

  Fly    61 PLCERIVHSFFAESNDDRVNFRQFMNVLAHFRPLRDNKQSKLNSR-EEKLKFAFKMYDLDDDGVI 124
            .|....|...|...::..:.|.:|...|:.|.|         |:. ::|:.|:|::|||...|.|
plant    84 SLFADRVFDLFDTKHNGILGFEEFARALSVFHP---------NAPIDDKIHFSFQLYDLKQQGFI 139

  Fly   125 SRDELLSILHMMV------GANISQDQLVSIAERTILEADLCCQGKISFEDF-CKALDRTDVDQK 182
            .|.|   :..|:|      |.|:....:..|.::|..|||....|||..|:: ...|....:.:.
plant   140 ERQE---VKQMVVATLAESGMNLKDTVIEDIIDKTFEEADTKHDGKIDKEEWRSLVLRHPSLLKN 201

  Fly   183 MSIRFL 188
            |::::|
plant   202 MTLQYL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 43/165 (26%)
CBL2NP_001332655.1 FRQ1 36..198 CDD:227455 45/177 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4251
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.