DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and CBL9

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_199521.1 Gene:CBL9 / 834756 AraportID:AT5G47100 Length:213 Species:Arabidopsis thaliana


Alignment Length:183 Identity:48/183 - (26%)
Similarity:82/183 - (44%) Gaps:34/183 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRN--DCGTLSREDLMRIPELAI-------NPLC 63
            |..:|...::..||.|:.:::|.||..|.|:..:  |.|.:::|:.    :||:       |...
plant    12 FPDHENPVKLASETAFSVSEVEALYELFKSISSSVVDDGLINKEEF----QLALFKNRKKENLFA 72

  Fly    64 ERIVHSFFAESNDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDE 128
            .|| ...|.......::|..|:..|..|.|..        |.|||..|.|::||:|..|.|.|.|
plant    73 NRI-FDLFDVKRKGVIDFGDFVRSLNVFHPNA--------SLEEKTDFTFRLYDMDCTGFIERQE 128

  Fly   129 LLSILHMMV---GANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTD 178
            :..:|..::   ...::.|.:..|.::|..:||:...|||         |:|:
plant   129 VKQMLIALLCESEMKLADDTIEMILDQTFEDADVDRDGKI---------DKTE 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 42/161 (26%)
CBL9NP_199521.1 FRQ1 25..183 CDD:227455 45/170 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.