DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and SOS3

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001190377.1 Gene:SOS3 / 832494 AraportID:AT5G24270 Length:222 Species:Arabidopsis thaliana


Alignment Length:165 Identity:48/165 - (29%)
Similarity:79/165 - (47%) Gaps:31/165 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TGFTPNQIERLYSRFTSLDRN--DCGTLSREDLMRIPELAI-------NPLCERIVHSFFAESND 76
            |.||..::|.||..|..|..:  |.|.:.:|:.    :||:       |...:||...|..:.| 
plant    29 TPFTVEEVEALYELFKKLSSSIIDDGLIHKEEF----QLALFRNRNRRNLFADRIFDVFDVKRN- 88

  Fly    77 DRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDEL----LSILH--M 135
            ..:.|.:|:..|..|.|..        ...||:|||||:|||...|.|.|:||    :::||  .
plant    89 GVIEFGEFVRSLGVFHPSA--------PVHEKVKFAFKLYDLRQTGFIEREELKEMVVALLHESE 145

  Fly   136 MVGANISQDQLVSIAERTILEADLCCQGKISFEDF 170
            :|   :|:|.:..:.::..::||....|||..:::
plant   146 LV---LSEDMIEVMVDKAFVQADRKNDGKIDIDEW 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 47/163 (29%)
SOS3NP_001190377.1 FRQ1 29..187 CDD:227455 48/165 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.