DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and CBL7

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_194386.1 Gene:CBL7 / 828763 AraportID:AT4G26560 Length:214 Species:Arabidopsis thaliana


Alignment Length:195 Identity:47/195 - (24%)
Similarity:85/195 - (43%) Gaps:39/195 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TGFTPNQIER--LYSRFTSLDRNDC---------------GTLSREDLMRIPELAI------NPL 62
            ||...:|.:|  ||..|..|...||               |.:::|..    .:||      ..|
plant    13 TGCFTDQKKRKALYEVFKKLSGVDCQRNEGNVVEGVTCYYGEMNKEQF----HVAIFQTDKNESL 73

  Fly    63 CERIVHSFFAESNDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRD 127
            ....|...|..::|..:.|.:|...|:.|.|..        ..::|:..:|::|||...|.|.|.
plant    74 FSERVFDLFDTNHDGLLGFEEFARALSVFHPSA--------PIDDKIDLSFQLYDLKQQGFIERQ 130

  Fly   128 ELLS-ILHMMVGANISQ-DQLV-SIAERTILEADLCCQGKISFEDFCKALDRTDVDQK-MSIRFL 188
            .:.. ::..:..:.:|| |::| ||.::|.::||...:|.|..|::...:.|..:..| |::::|
plant   131 GVKQLVVATLAASGMSQSDEIVESIIDKTFVQADTKHEGMIDEEEWMDLVFRHPLLLKNMTLQYL 195

  Fly   189  188
            plant   196  195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 41/175 (23%)
CBL7NP_194386.1 FRQ1 <74..186 CDD:227455 29/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4251
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.