DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and CBL1

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001329533.1 Gene:CBL1 / 827481 AraportID:AT4G17615 Length:252 Species:Arabidopsis thaliana


Alignment Length:178 Identity:45/178 - (25%)
Similarity:83/178 - (46%) Gaps:28/178 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRN--DCGTLSREDLMRIPELAI-------NPLC 63
            |..:|:..::..||.|:.:::|.|:..|.|:..:  |.|.:::|:.    :||:       |...
plant    12 FRGHEDPVKLASETAFSVSEVEALFELFKSISSSVVDDGLINKEEF----QLALFKSRKRENIFA 72

  Fly    64 ERIVHSFFAESNDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDE 128
            .|| ...|.......::|..|:..|..|.|..        |.|:|:.|.|::||:|..|.|.|.|
plant    73 NRI-FDMFDVKRKGVIDFGDFVRSLNVFHPNA--------SLEDKIDFTFRLYDMDCTGYIERQE 128

  Fly   129 LLSILHMMV---GANISQDQLVSIAERTILEADLCCQGKI---SFEDF 170
            :..:|..::   ...::.:.:..|.::|..:||:...|||   .:.||
plant   129 VKQMLIALLCESEMKLADETIEIILDKTFEDADVNQDGKIDKLEWSDF 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 41/163 (25%)
CBL1NP_001329533.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4251
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.