DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and CBL5

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_192051.2 Gene:CBL5 / 826671 AraportID:AT4G01420 Length:203 Species:Arabidopsis thaliana


Alignment Length:169 Identity:44/169 - (26%)
Similarity:79/169 - (46%) Gaps:17/169 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RNEEIAQIQEETGFTPNQIERLYSRF---TSLDRNDCGTLSRE--DLMRIPELAINPLCERIVHS 69
            |.|:|:.:..:|.|:..::|.|:..|   ||...|| ..|::|  ..:.|.......|....:..
plant    13 RQEDISLLASQTFFSEAEVEVLHGLFIKLTSCLSND-NLLTKEKFQFILIKNTKKRSLSAERIFG 76

  Fly    70 FFAESNDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELLSILH 134
            .|...||..::|.:|::.|..|.|        .:|..:|..|||::||..:.|.|..:|:..::.
plant    77 LFDMRNDGAIDFGEFVHTLNIFHP--------NSSPRDKAIFAFRLYDTRETGFIEPEEVKEMII 133

  Fly   135 MMVGAN---ISQDQLVSIAERTILEADLCCQGKISFEDF 170
            .::..:   :|:..:.||..:|..|||....|.|..|::
plant   134 DVLEESELMLSESIIDSIVSKTFEEADWKKDGIIDLEEW 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 40/156 (26%)
CBL5NP_192051.2 FRQ1 13..181 CDD:227455 44/169 (26%)
EFh 71..132 CDD:298682 18/68 (26%)
EFh 107..172 CDD:238008 19/64 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.