DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and AT3G59450

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_191504.1 Gene:AT3G59450 / 825114 AraportID:AT3G59450 Length:148 Species:Arabidopsis thaliana


Alignment Length:153 Identity:33/153 - (21%)
Similarity:59/153 - (38%) Gaps:44/153 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SLFLRNEEIAQIQE-ETGFTPN-------------QIER-LYSRFTSLDRNDCGTLSREDLMRIP 55
            ::.|.:||||.::: |.|:..|             |||| .::....|.:.:|..::.|    ||
plant    22 AIALVDEEIANLRKLERGYQTNIRNAENARDQTNVQIERDSFNDTIRLLQAECNLINLE----IP 82

  Fly    56 ELAINPLCERIVHSFFAESNDDRVNFRQFMNVLAHFRPLRDNKQSK-LNSREEKLKFAFKMYDLD 119
            .|                 |:::....:..:....|..:...|:.| |...:|.:|      .:|
plant    83 TL-----------------NEEKFAITRLKSAKHFFGAVSSLKEGKALECCKEMIK------QVD 124

  Fly   120 DDGVISRDELLSILHMMVGANIS 142
            :|| ..|.:....|.||...:.|
plant   125 EDG-HGRVDYKEFLQMMKTGDFS 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 26/135 (19%)
AT3G59450NP_191504.1 EFh <96..141 CDD:238008 12/51 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.