DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and AT3G18430

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001189924.1 Gene:AT3G18430 / 821372 AraportID:AT3G18430 Length:175 Species:Arabidopsis thaliana


Alignment Length:189 Identity:54/189 - (28%)
Similarity:97/189 - (51%) Gaps:19/189 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKSSLFLRNEEIAQIQEETG--FTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAINPLC 63
            |||.||: |...:|.::|....  |...:|..||.||..||||..|.:|.::.:.:||.|:|||.
plant     1 MGNTSSM-LTQYDIEEVQSHCHDLFEQQEILSLYQRFCQLDRNAKGFISADEFLSVPEFAMNPLS 64

  Fly    64 ERIVHSFFAESNDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDE 128
            :|::...      |.:||:.|:..|:.|        |...|..:|::..||:||.|.:|.:|..:
plant    65 QRLLKMV------DGLNFKDFVAFLSAF--------SAKASLRQKVQLIFKVYDSDCNGKVSFKD 115

  Fly   129 LLSILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKAL--DRTDVDQKMSI 185
            ::.:|..:.|:.:|.:|...:..:.:.|:.......::.|||.|..  .|.::|.::.:
plant   116 IMEVLRDLSGSFMSDEQREQVLSQVLKESGYTSDSFLTLEDFIKIFGSSRPEMDVEIPV 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 43/149 (29%)
AT3G18430NP_001189924.1 FRQ1 24..161 CDD:227455 44/150 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 47 1.000 Domainoid score I4561
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2267
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 1 1.000 - - otm2564
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.840

Return to query results.
Submit another query.