DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and AT3G03400

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_186990.1 Gene:AT3G03400 / 821266 AraportID:AT3G03400 Length:137 Species:Arabidopsis thaliana


Alignment Length:163 Identity:44/163 - (26%)
Similarity:73/163 - (44%) Gaps:41/163 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LYSRF-TSLDRNDCGTLSREDLMRIPELAINPL--CERIVHSFFA--ESNDDRVNFRQFMNVLAH 90
            ::.|| ||.|    |.:|.|: .|....|::|.  .|::|..|..  .:.|.:|:..:|.:.   
plant     9 IFERFDTSKD----GKISWEE-FRDAIHALSPSIPSEKLVEMFIQLDTNGDGQVDAAKFASC--- 65

  Fly    91 FRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELLSILHMMVGANISQDQLVSIAERTIL 155
               :....||.....|::||.|||:||::.||.||.:|    ||::         :..:.|:..:
plant    66 ---MDQTAQSSGGDVEKELKDAFKLYDINCDGKISANE----LHVV---------MTRLGEKCTV 114

  Fly   156 EADLCCQGKISFEDFCKALDRTDVDQKMSIRFL 188
            |:   |.|.:         ...|||....|||:
plant   115 ES---CVGMV---------QAIDVDGDGYIRFV 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 38/146 (26%)
AT3G03400NP_186990.1 PTZ00184 10..134 CDD:185504 42/159 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.