DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and AT3G03410

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_186991.1 Gene:AT3G03410 / 821262 AraportID:AT3G03410 Length:131 Species:Arabidopsis thaliana


Alignment Length:147 Identity:36/147 - (24%)
Similarity:67/147 - (45%) Gaps:32/147 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ERLYSRFTSLDRNDCGTLSREDLMRIPELAINP-LCERIVHSFFAESNDD---RVNFRQFMNVLA 89
            :|::.:|   |:|..|.||.::...: .||.:| ..:..:..||.|.:.|   .:|..:|.:.: 
plant     4 KRVFEKF---DKNKDGKLSLDEFREV-ALAFSPYFTQEDIVKFFEEIDVDGNGELNADEFTSCI- 63

  Fly    90 HFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELLSILHM-MVGANISQDQLVSIAERT 153
                            |:.||..|...|:|.||.|...|  |.:.| .:|...:::   :.||: 
plant    64 ----------------EKMLKEVFVFCDVDGDGKIPASE--SYVTMTSLGKKFTEE---TSAEK- 106

  Fly   154 ILEADLCCQGKISFEDF 170
            :..||:...|.::|::|
plant   107 VRAADVDGDGYLNFDEF 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 36/147 (24%)
AT3G03410NP_186991.1 PTZ00184 4..128 CDD:185504 36/147 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.020

Return to query results.
Submit another query.