DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and MSS3

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_565996.1 Gene:MSS3 / 818931 AraportID:AT2G43290 Length:215 Species:Arabidopsis thaliana


Alignment Length:158 Identity:35/158 - (22%)
Similarity:82/158 - (51%) Gaps:22/158 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PNQIERLYSRFTSLDRNDCGTLSREDL--------MRIPELAINPLCERIVHSFFAESNDDRVNF 81
            |::::|::..|   |:|..|.:::|:|        :.||:..:.    :::|...| :.|..|:.
plant    63 PSELKRVFQMF---DKNGDGRITKEELNDSLENLGIYIPDKDLT----QMIHKIDA-NGDGCVDI 119

  Fly    82 RQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELLSILHMMVGANISQDQL 146
            .:|.::   :..:.|...:...:.||.:|.||.::|.|.||.|:.:||.|:   |....:.|.:.
plant   120 DEFESL---YSSIVDEHHNDGETEEEDMKDAFNVFDQDGDGFITVEELKSV---MASLGLKQGKT 178

  Fly   147 VSIAERTILEADLCCQGKISFEDFCKAL 174
            :...::.|::.|....|::::::|.:.:
plant   179 LDGCKKMIMQVDADGDGRVNYKEFLQMM 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 35/155 (23%)
MSS3NP_565996.1 PTZ00184 64..206 CDD:185504 34/155 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.