DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and rcvrnb

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001304684.1 Gene:rcvrnb / 792903 ZFINID:ZDB-GENE-120815-1 Length:203 Species:Danio rerio


Alignment Length:152 Identity:40/152 - (26%)
Similarity:73/152 - (48%) Gaps:21/152 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDC--GTLSREDLMRI-----PELA 58
            |||..|..|..:.:.::|..|.::..|:...|.:|.    |:|  |.:|||....|     |:..
Zfish     1 MGNSRSSALSRDVLQELQTSTTYSQEQLFSWYQKFL----NECPTGRISREQFQSIYASFFPDAD 61

  Fly    59 INPLCERIVHSFFAESNDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGV 123
            .....:.:..||.|:| |..::|:::: |..|.        :......|||::||.:||:|.:|.
Zfish    62 PGAYAQHVFRSFDADS-DGTLDFKEYI-VALHL--------TSSGKTVEKLEWAFALYDVDRNGS 116

  Fly   124 ISRDELLSILHMMVGANISQDQ 145
            |:::|:..|:..:......:||
Zfish   117 ITKNEIHEIVKSIFNMISKEDQ 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 33/130 (25%)
rcvrnbNP_001304684.1 FRQ1 10..182 CDD:227455 35/143 (24%)
EFh 65..127 CDD:238008 20/71 (28%)
EFh 101..177 CDD:238008 13/38 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.