DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and guca1al

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001072507.1 Gene:guca1al / 779962 XenbaseID:XB-GENE-5751697 Length:188 Species:Xenopus tropicalis


Alignment Length:202 Identity:48/202 - (23%)
Similarity:85/202 - (42%) Gaps:48/202 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDC--GTLSREDLMRIPEL-----A 58
            |||.||     ..:..:|..      :|...|.:|.:    :|  |.|:..:..:...|     .
 Frog     1 MGNTSS-----STVDDLQAV------EIHHWYKKFMT----ECPSGQLTLHEFKQFFGLRGLSGE 50

  Fly    59 INPLCERIVHSFFAESNDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGV 123
            .|...|::..: |..:.|..::|.:::..|:  ..||    .|:   |:||::.||:||:|.:|.
 Frog    51 ANSYIEQMFRT-FDMNKDGYIDFMEYVAALS--LVLR----GKI---EQKLRWYFKLYDVDGNGC 105

  Fly   124 ISRDELLSILHMMVGANISQDQLVS--IAERTILEADLCCQGKISFEDF--------------CK 172
            |.|.|||:|:..:...|.......:  ...|...:.|:...|::|.|:|              .|
 Frog   106 IDRHELLNIIKAVRAINGCDHDTTAEEFTNRVFDKIDVNGDGELSLEEFVEGARKDEEFMDVMMK 170

  Fly   173 ALDRTDV 179
            :||.|.:
 Frog   171 SLDLTHI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 38/172 (22%)
guca1alNP_001072507.1 FRQ1 16..162 CDD:227455 38/159 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.