DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and tesc

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001072423.1 Gene:tesc / 779877 XenbaseID:XB-GENE-991111 Length:214 Species:Xenopus tropicalis


Alignment Length:198 Identity:70/198 - (35%)
Similarity:111/198 - (56%) Gaps:22/198 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAINPLCERIVHSFFAESN-- 75
            |..|:.|:|||:..|||.|:.||.||. .|..|:.:..|..|.:|.:||:..:||.:||.:.|  
 Frog    10 ETRQLVEKTGFSAEQIEHLHKRFNSLS-GDLLTIRKGHLNGISDLEVNPIRSKIVDAFFDKRNLR 73

  Fly    76 ------DDRVNFRQFMNVLAHFRPLRDNKQSKLNS--REEKLKFAFKMYDLDDDGVISRDELLSI 132
                  .:.:||.:|:.::::||||..|...:..|  |::||:|.|.|||.|:|..|:.:|...:
 Frog    74 KGSSGYVEEINFEEFLTIMSYFRPLSQNMDEENISVCRKDKLRFLFNMYDTDNDSKITLEEYRKV 138

  Fly   133 LHMMVGA--NISQDQLVSIAERTILEADLCCQGK---------ISFEDFCKALDRTDVDQKMSIR 186
            :..::..  ||.::...|||:..:|||...|.|:         |:|:||.|..:..|::.||.||
 Frog   139 VEELLSGNPNIEKETARSIADGAMLEAASICVGQMEPDQVYEGITFDDFLKIWEGIDIETKMHIR 203

  Fly   187 FLN 189
            |||
 Frog   204 FLN 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 56/170 (33%)
tescNP_001072423.1 EFh_PEF 12..>142 CDD:330173 46/130 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.