DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and Cib4

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_082759.1 Gene:Cib4 / 73259 MGIID:1920509 Length:185 Species:Mus musculus


Alignment Length:186 Identity:46/186 - (24%)
Similarity:88/186 - (47%) Gaps:25/186 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EEIAQIQEETGFTPNQIERLYSRFTSLDRNDC--------GTLSREDLMRIPELAINPLCERIVH 68
            |::.:.|..|..|.|:|..::..|..|    |        .||:.:.:..:|.|.:||..:||..
Mouse    12 EDLEEYQALTFLTRNEILCIHDTFLKL----CPSGKHYKEATLTMDQVSSLPALRVNPFRDRICR 72

  Fly    69 SFFAESNDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELLSI- 132
            .|   |:|:..:|...:.:.:.|        |:......|:::||::||.:::|.|..::|..| 
Mouse    73 VF---SHDNVFSFEDVLGMASVF--------SEQACPSLKIEYAFRIYDFNENGFIDEEDLEEIV 126

  Fly   133 LHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRT-DVDQKMSIRF 187
            |.::...:.|:|.|:.:....:.|:||.....:||.:|..|:.:: |......|.|
Mouse   127 LRLLKSDDASEDLLMDVMHHVLSESDLDNDSMLSFSEFEHAMAKSPDFMNSFRIHF 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 39/158 (25%)
Cib4NP_082759.1 FRQ1 21..173 CDD:227455 41/166 (25%)
EFh 101..169 CDD:238008 20/67 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846963
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.