DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and Chp2

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_081639.1 Gene:Chp2 / 70261 MGIID:1917511 Length:196 Species:Mus musculus


Alignment Length:196 Identity:94/196 - (47%)
Similarity:132/196 - (67%) Gaps:9/196 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAINPLCER 65
            ||::||......::..|:.||||:...:.|||.||.:|||::.|.|||.||.:|..||:|||.:|
Mouse     1 MGSRSSHIALIPDVEHIRRETGFSQASLLRLYHRFQALDRDEKGFLSRLDLQQIGALAVNPLGDR 65

  Fly    66 IVHSFFAESNDDRVNFRQFMNVLAHFRP-------LRDNKQSK-LNSREEKLKFAFKMYDLDDDG 122
            |:.||| .:...|:.|..|..|||:|||       |||.||.: ||||..||:|||::||||.||
Mouse    66 IIDSFF-PNGSQRLYFAGFARVLAYFRPIDEEDATLRDPKQPEPLNSRMNKLRFAFQLYDLDRDG 129

  Fly   123 VISRDELLSILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTDVDQKMSIRF 187
            .|||:|:|.:|.:|||..::.:||.||.:||:.|||....|.:||.:|.|:|::.:::||||||.
Mouse   130 KISRNEMLQVLRLMVGVQVTDEQLESITDRTVQEADEDGDGAVSFLEFTKSLEKMNIEQKMSIRI 194

  Fly   188 L 188
            |
Mouse   195 L 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 77/157 (49%)
Chp2NP_081639.1 FRQ1 23..179 CDD:227455 77/156 (49%)
Nuclear export signal. /evidence=ECO:0000250 137..148 5/10 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846976
Domainoid 1 1.000 78 1.000 Domainoid score I8746
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 228 1.000 Inparanoid score I3452
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 1 1.000 - - otm44276
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46002
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2469
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.870

Return to query results.
Submit another query.