DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and Chp1

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_077053.1 Gene:Chp1 / 64152 RGDID:620447 Length:195 Species:Rattus norvegicus


Alignment Length:196 Identity:119/196 - (60%)
Similarity:151/196 - (77%) Gaps:8/196 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAINPLCER 65
            ||:::|..||:||:.:|::||||:.:||.||||||||||:.:.|||||||..||||||||||.:|
  Rat     1 MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDR 65

  Fly    66 IVHSFFAESNDDRVNFRQFMNVLAHFRPLRDNKQSK-------LNSREEKLKFAFKMYDLDDDGV 123
            |:::||:| .:|:||||.||..||||||:.||::||       ||||..||.|||::||||.|..
  Rat    66 IINAFFSE-GEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDDK 129

  Fly   124 ISRDELLSILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTDVDQKMSIRFL 188
            |||||||.:|.||||.|||.:||.|||:|||.|||......|||.:|.|.|::.||:||||||||
  Rat   130 ISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFL 194

  Fly   189 N 189
            :
  Rat   195 H 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 96/156 (62%)
Chp1NP_077053.1 FRQ1 1..182 CDD:227455 109/181 (60%)
Necessary for association with microtubule and interaction with GAPDH 2..6 1/3 (33%)
Nuclear export signal 1 138..147 5/8 (63%)
Nuclear export signal 2 176..185 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350458
Domainoid 1 1.000 132 1.000 Domainoid score I4999
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5235
Inparanoid 1 1.050 228 1.000 Inparanoid score I3383
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 1 1.000 - - otm46375
orthoMCL 1 0.900 - - OOG6_105864
Panther 1 1.100 - - LDO PTHR46002
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2469
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.