DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and Kcnip2

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_064479.2 Gene:Kcnip2 / 56817 RGDID:70887 Length:270 Species:Rattus norvegicus


Alignment Length:200 Identity:48/200 - (24%)
Similarity:93/200 - (46%) Gaps:52/200 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDC--GTLSREDLMRIPELAINPLCERIV 67
            |::..|.|.:.|:||:|.||..:::.||..|    :|:|  |.::.|:.            ::|.
  Rat    84 STVCHRPEGLEQLQEQTKFTRRELQVLYRGF----KNECPSGIVNEENF------------KQIY 132

  Fly    68 HSFFAE----------------SNDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMY 116
            ..||.:                ::|..|:|..|:..|:..  ||       .:.:::|.:||.:|
  Rat   133 SQFFPQGDSSNYATFLFNAFDTNHDGSVSFEDFVAGLSVI--LR-------GTIDDRLSWAFNLY 188

  Fly   117 DLDDDGVISRDELLSI---LHMMVGANISQDQLVSIAERTILEA-----DLCCQGKISFEDFCKA 173
            ||:.||.|:::|:|.|   ::.|:| ..:...|...|.|..:|:     |....|.::.|:|.::
  Rat   189 DLNKDGCITKEEMLDIMKSIYDMMG-KYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFIES 252

  Fly   174 LDRTD 178
            ..:.:
  Rat   253 CQQDE 257

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 41/175 (23%)
Kcnip2NP_064479.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
FRQ1 93..259 CDD:227455 45/190 (24%)