DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and si:ch211-245j22.3

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001074270.1 Gene:si:ch211-245j22.3 / 563798 ZFINID:ZDB-GENE-050419-38 Length:194 Species:Danio rerio


Alignment Length:170 Identity:45/170 - (26%)
Similarity:78/170 - (45%) Gaps:45/170 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RNDC-GTLSREDLMRIPELAINPLCERIVHSFFAESNDDR-VNFRQFMNVLAHFRPLRDNKQSKL 102
            |:.| ||:.:|.    .|.|     |:|..:.  ::|.|. |:||:::..:           |.|
Zfish    42 RHFCNGTVGKES----AEYA-----EQIFRTL--DNNGDGVVDFREYVTAI-----------SML 84

  Fly   103 --NSREEKLKFAFKMYDLDDDGVISRDELLSILH----MMVGANISQDQLVSIAERT-------- 153
              .|..|||:::||:||.|.||.|:|.|:|.|:.    |.|.|::::...::..|.|        
Zfish    85 IEGSTVEKLRWSFKLYDKDKDGAITRSEMLEIMQAVYKMSVAASLTKPDPLTAEECTNRIFVRLD 149

  Fly   154 -----ILEADLCCQGKISFEDFCKAL--DRTDVDQKMSIR 186
                 |:..|...:|.::.|...:.|  |...|..:.|::
Zfish   150 KDNNAIISQDEFIEGALNDEWIREMLECDPNTVKMERSLK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 41/153 (27%)
si:ch211-245j22.3NP_001074270.1 EF-hand_8 31..78 CDD:290545 14/46 (30%)
EF-hand_7 32..81 CDD:290234 14/49 (29%)
EFh 56..118 CDD:238008 26/79 (33%)
EF-hand_7 57..117 CDD:290234 25/77 (32%)
EFh 92..164 CDD:238008 21/71 (30%)
EF-hand_7 93..163 CDD:290234 20/69 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.