DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and PPP3R2

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_671709.2 Gene:PPP3R2 / 5535 HGNCID:9318 Length:170 Species:Homo sapiens


Alignment Length:183 Identity:65/183 - (35%)
Similarity:101/183 - (55%) Gaps:17/183 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAINPLCER 65
            |||::|.        ..:..:.|..::|:||..||..||.:..|:||.|:.|.:|||..|||..|
Human     1 MGNEASY--------PAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRR 57

  Fly    66 IVHSFFAESNDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELL 130
            :: ..|....|..|:|::|:        |..::.|.....|:||:|||.:||:|.||.||..||.
Human    58 VI-DVFDTDGDGEVDFKEFI--------LGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELF 113

  Fly   131 SILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTDVDQKM 183
            .:|.||||.|::..||..:.::||:..|....||||||:|...:...::.:|:
Human   114 QVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKL 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 60/149 (40%)
PPP3R2NP_671709.2 FRQ1 13..159 CDD:227455 60/154 (39%)
Calcineurin A binding. /evidence=ECO:0000250|UniProtKB:P63098 131..136 0/4 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156558
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.