DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and cib1

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001017681.1 Gene:cib1 / 550376 ZFINID:ZDB-GENE-050417-170 Length:188 Species:Danio rerio


Alignment Length:186 Identity:47/186 - (25%)
Similarity:92/186 - (49%) Gaps:18/186 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCG----TLSREDLMRIPELAINP 61
            ||..:|. |..|.:::.||.|..|..:|...:.||:.|...:.|    .:|.|.::.:|||..||
Zfish     1 MGGTASK-LPKELLSEYQELTFLTKQEILLAHKRFSELQGRENGPYSSRVSMEKILTLPELKSNP 64

  Fly    62 LCERIVHSF-FAESNDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVIS 125
            ..:||.|.| .::..|..:.|..|:::|:.|        |...:.|.|..:||:::|.||||.:.
Zfish    65 FRKRICHVFSTSDLRDGSLTFEDFLDLLSAF--------SDSATLEIKSHYAFRIFDFDDDGTLD 121

  Fly   126 RDELLSILHMMVG----ANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRT 177
            ..:|..:::.:.|    ..::.:::..:....:.|:|:...|.::..:|...:.|:
Zfish   122 GRDLEKLVNCLTGETDDTRLTAEEMRQLISNILEESDIDKDGTVNPSEFQHVISRS 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 38/158 (24%)
cib1NP_001017681.1 FRQ1 4..179 CDD:227455 45/183 (25%)
EFh 108..175 CDD:238008 13/66 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592185
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.