DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and TESC

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_016875021.1 Gene:TESC / 54997 HGNCID:26065 Length:251 Species:Homo sapiens


Alignment Length:201 Identity:66/201 - (32%)
Similarity:116/201 - (57%) Gaps:22/201 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAINPLCERI 66
            |...:....:||:.:::.:|||:.:|||:|:.||..|. .|..|:.:|:...:|:|.:||:..:|
Human    52 GTMGAAHSASEEVRELEGKTGFSSDQIEQLHRRFKQLS-GDQPTIRKENFNNVPDLELNPIRSKI 115

  Fly    67 VHSFFAESN--------DDRVNFRQFMNVLAHFRPL---RDNKQSKLNSREEKLKFAFKMYDLDD 120
            |.:||...|        .|.:||..|:.::::|||:   .|.:|.:| ||:|||:|.|.|||.|.
Human   116 VRAFFDNRNLRKGPSGLADEINFEDFLTIMSYFRPIDTTMDEEQVEL-SRKEKLRFLFHMYDSDS 179

  Fly   121 DGVISRDELLSILHMMVGAN--ISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTDVDQKM 183
            ||.|:.:|..:::..::..|  |.::...|||:..::||...|.|::.::..       |::.||
Human   180 DGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQMIWQGI-------DIETKM 237

  Fly   184 SIRFLN 189
            .:||||
Human   238 HVRFLN 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 54/162 (33%)
TESCXP_016875021.1 FRQ1 73..>195 CDD:227455 45/123 (37%)
EFh 167..>195 CDD:298682 12/27 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156538
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.