DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and chp1

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001004859.1 Gene:chp1 / 448152 XenbaseID:XB-GENE-1007598 Length:193 Species:Xenopus tropicalis


Alignment Length:194 Identity:119/194 - (61%)
Similarity:147/194 - (75%) Gaps:6/194 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAINPLCER 65
            ||:::|..||:|||.:|::||||:.:||.||||||||||:.:.|||||||..||||||||||.:|
 Frog     1 MGSRASTLLRDEEIEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDR 65

  Fly    66 IVHSFFAESNDDRVNFRQFMNVLAHFRPLRD-----NKQSKLNSREEKLKFAFKMYDLDDDGVIS 125
            |:::||.| .:|:||||.||..||||||:.|     |.|..||||..||.|||::||||.|..||
 Frog    66 IINAFFTE-GEDQVNFRGFMRTLAHFRPIEDNSKDANSQEPLNSRSNKLLFAFRLYDLDKDDKIS 129

  Fly   126 RDELLSILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTDVDQKMSIRFLN 189
            |:|||.:|.||||.|||.|||.|||:|||.|||......|||.:|.|.|::.||:||||||||:
 Frog   130 REELLQVLRMMVGVNISDDQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 95/154 (62%)
chp1NP_001004859.1 FRQ1 1..180 CDD:227455 109/179 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 131 1.000 Domainoid score I5112
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5235
Inparanoid 1 1.050 227 1.000 Inparanoid score I3399
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 1 1.000 - - oto105439
Panther 1 1.100 - - LDO PTHR46002
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3958
SonicParanoid 1 1.000 - - X2469
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.