DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and CG14362

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_650320.1 Gene:CG14362 / 41695 FlyBaseID:FBgn0038186 Length:206 Species:Drosophila melanogaster


Alignment Length:172 Identity:46/172 - (26%)
Similarity:83/172 - (48%) Gaps:8/172 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IQEETGFTPNQIERLYSRFTSLD---RNDCGTLSREDLMRIPELAINPLCERIVHSFFAESNDDR 78
            ::..|..:.:||:.||.||....   ::....|.:.:... ..|.:|||...|::|.|  .|...
  Fly    23 LRMNTALSRSQIKYLYIRFHQFSGGGKDPPSHLHKYNFYS-GLLQLNPLLPTILNSMF--GNKVT 84

  Fly    79 VNFRQFMNVLAHFR--PLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELLSILHMMVGANI 141
            :.|..|...|:.|:  .|:.:.:.|....::||:..|.|||.:.||.|::.:|:.::|.:....:
  Fly    85 ITFVDFALFLSTFQAHSLKTSNELKNVMMDKKLRLIFNMYDNNKDGRITKYDLVVVVHKLFSNLL 149

  Fly   142 SQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTDVDQKM 183
            ...|::.|....:.|.|.....:|.|:|||||....|:.:.|
  Fly   150 DHVQIMRIVNTIMKEMDHTDSNQIMFQDFCKAFAVFDMTEMM 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 41/154 (27%)
CG14362NP_650320.1 EFh 116..183 CDD:238008 22/66 (33%)
EF-hand_7 117..182 CDD:290234 20/64 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469400
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46002
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.